Garden-fresh finds · Free shipping over $65 · Browse the beds
Login Register
***Immunotag™ Human Prokineticin-2 ELISA Kit, 96-Well Plate, Made to Order, Non-Cancellable, Non-Returnable, Non-Refundable 9020-Tandutinib Cresyl Diphenyl Phosphate
***Immunotag™ Human Prokineticin-2 ELISA Kit, 96-Well Plate, Made to Order, Non-Cancellable, Non-Returnable, Non-Refundable 9020-Tandutinib Cresyl Diphenyl Phosphate
***Immunotag™ Human Prokineticin-2 ELISA Kit, 96-Well Plate, Made to Order, Non-Cancellable, Non-Returnable, Non-Refundable 9020-Tandutinib Cresyl Diphenyl Phosphate
***Immunotag™ Human Prokineticin-2 ELISA Kit, 96-Well Plate, Made to Order, Non-Cancellable, Non-Returnable, Non-Refundable 9020-Tandutinib Cresyl Diphenyl Phosphate

***Immunotag™ Human Prokineticin-2 ELISA Kit, 96-Well Plate, Made to Order, Non-Cancellable, Non-Returnable, Non-Refundable 9020-Tandutinib Cresyl Diphenyl Phosphate

SKU: 95624147808

4.2
USD854.50 USD886.50

Pay in 4 interest-free payments of $213.62 Learn more

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 10 - Sep 15

Description

Cresyl Diphenyl Phosphate

universal pan-specific secondary antibody included in the kit recognizes mouse

The engagement of TREMs

3 kDa) (Amino Acid Sequence: AAVHSVNCRLRDIYHKSLVLSGACELQAVHLNGENTNQQVVFCMSFVQGEEETDKIPVALGLKEKNLYLSCGMKDGKPTLQLETVDPNTYPKRKMEKRFVFNKMEIKGNVEFESAMYPNWYISTSQAEKKPVFLGNTRGGRDITDFIMEITSA) (Gene ID: 100034237)

2-Chloronicotinic acid

***Immunotag™ Human Prokineticin-2 ELISA Kit, 96-Well Plate, Made to Order, Non-Cancellable, Non-Returnable, Non-Refundable 9020-Tandutinib Cresyl Diphenyl Phosphate

Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

You may also like

recommand products